DPCstruct | MC58521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 271 ± 52 aa |
| Standard deviation of domain lengths | 52.34 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.24 |
| Pfam Score | 76.32 |
| Assigned Pfam label(s) | CL0310- CL0056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090WR81 | 11-250 | RQQTIDFCSHLHPEDYAIQVVKFASPAKWHLAHTTWFFETFILKAELDGYVEYDSNFNFLFNSYYNNVGSRVLQSNRGNMSRPSTDT… |
| A0A829MB27 | 1-287 | MSREELARDLEAARMRTLTITDHDDAELHRQYDPLMSPLVWDLAHIGQQEELWLLRGGDPRRPGMLPDEIESLYDAFRHTRASRVQL… |
| A0A354TSF8 | 2-266 | None |
| A0A2G8LNU6 | 54-310 | None |
| M4TNL3 | 21-291 | None |
| A0A2N8U6A8 | 553-879 | None |
| A0A177VBS6 | 600-977 | None |
| A0A842YT39 | 26-234 | None |
| A0A7S2MKF6 | 117-431 | None |
| A0A179HE29 | 82-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.