DPCstruct | MC5852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12544 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645IFK4 | 24-118 | TSGFCVPTFVVDAPGGGGKTPVMPNYVISQTPHRVILRNYEGVITTYTEPDHYEESCHCEVCQGKKKVELMGVVGLEYGQALSMEPA… |
| A0A168DTB9 | 2-97 | AVPTFVVDAPGGGGKIPINPQYLISQSSEKLVLRNYEGVLCTYTEPEDKTHQCKNCGLCAKFKKDDYKGLEKLFRDERVCLTPRSNV… |
| A0A7C4M1J2 | 33-120 | None |
| A0A5S9MB46 | 85-193 | None |
| A0A7X9A7H8 | 179-272 | None |
| A0A559JGM8 | 19-124 | None |
| A0A257TKN6 | 43-131 | None |
| A0A7V6GCP6 | 76-163 | None |
| A0A1R4AEU3 | 1-75 | None |
| Q3Z9Y0 | 324-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.