DPCstruct | MC58518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 103 ± 15 aa |
| Standard deviation of domain lengths | 15.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.91 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0063- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090W918 | 1-98 | MKTGIVHVGIGGFHRSHEAFYTDQLLHDESNADWGICGVALLDFDAKIYNTLKEQDGLYTLVVKELDGTLTKRVIGSIVEVLYAPED… |
| A0A2T4RP92 | 1-87 | MKAVHFGAGNIGRGFIGYILADNNVKVTFADVNEEIINALAQDHQYDVILADESKTTTRVNNVDAINSMQPSEALKQAILEGDIITT |
| A0A2D0JWH4 | 402-527 | None |
| A0A377DB53 | 1-83 | None |
| A0A6G3VJS7 | 1-74 | None |
| A0A7S2RBF1 | 223-332 | None |
| A0A378MUB4 | 1-72 | None |
| A0A6L5X4B5 | 38-148 | None |
| A0A4R8UFY8 | 105-184 | None |
| A0A656H0T3 | 16-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.