DPCstruct | MC58517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 370 ± 85 aa |
| Standard deviation of domain lengths | 84.99 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 91.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090VHK3 | 46-405 | WYTTCLKNLSLVELLVEKDYPDDIYIVAQAKILEGFIYSNITQVWGEVPFTQAGNPAEYPYPVFDSQETVMEGIVTLMDEAIAILEQ… |
| A0A7Y3AW38 | 39-348 | QWNGSYRATKNANLLIEAASNTEFVTDAESNGYIGFAKTMQAYELIQVLKSYGRARLDVADPDNLGPILDFNEALSQIRALLDEAQG… |
| A0A1G6G5H2 | 55-490 | None |
| A0A7G9QC62 | 2-229 | None |
| A0A7X9HP42 | 4-290 | None |
| A0A5Q5G6A1 | 2-386 | None |
| I8YG77 | 47-504 | None |
| A0A4P8MNN7 | 607-1015 | None |
| A0A1I2CMD1 | 680-1222 | None |
| A0A3E4Z433 | 95-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.