DPCstruct | MC58507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 306 ± 56 aa |
| Standard deviation of domain lengths | 56.08 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1RPE9 | 2-313 | TNVSFQSVNGLGIAIDSLVFGEGASLYTVSIASSATFALRGMGIVNDSGSPQHFVVRPDGINGSTFQITNSATAGEGTFFEVDSSVL… |
| A0A1G6CXK3 | 208-475 | NDTASFEDDSSAADAEIVINETGTLTFLDEATAARAMLTVNGMVDFEDDSTAGNAEVIVNAGGTLTFGDNGSAGAADITNNDTVRFA… |
| A0A2G2D0Y1 | 5-280 | None |
| A0A2V5VHW1 | 47-266 | None |
| A0A5C8UCH9 | 1-275 | None |
| A0A0S6UWC5 | 1-347 | None |
| A0A2V6ADL3 | 22-407 | None |
| A0A7W1YXX2 | 1-216 | None |
| A0A5C8RZE3 | 2-332 | None |
| A0A7W1YWY6 | 321-609 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.