DPCstruct | MC58506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 315 ± 41 aa |
| Standard deviation of domain lengths | 40.91 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1RNL3 | 5-304 | GMLYLSARPLAWPGEPSAIITSLSVGATAAHPLQDFGYYPAYDRVTPEQRRSYLEWLAAGRQDSDPSQRSLGHVFMFFYGLERRVLL… |
| A0A2M8GMJ7 | 1-223 | MYFPSYSTLSPKHRYQYLNWLKDVTQETNLSYVFLYYYGLERHMLVGDYDKSVDEILRLLQYHNKGSFKGYATSALIAASAYKKRPD… |
| A0A2G9VNH3 | 35-346 | None |
| A0A7U3E011 | 31-352 | None |
| A0A540VKG6 | 10-283 | None |
| A0A1V4YUC6 | 21-329 | None |
| A0A847PER9 | 123-508 | None |
| A0A076N213 | 56-368 | None |
| A0A250LLN6 | 1-359 | None |
| A0A1F1E5G3 | 147-471 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.