DPCstruct | MC58505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 141 ± 17 aa |
| Standard deviation of domain lengths | 17.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.65 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0029- PF13968 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E5Y1C7 | 2-134 | LQSPFATPGVDTIDFVIFPPRWLAAENTFRPPWFHRNVASEFMGLIQGVYDAKAEGFVPGGASLHNCMSGHGPDAETFEKASNGDTS… |
| A0A0W0S6R5 | 268-408 | INSVSFDHPDPSIFTVLTSESDTPGVANLDFVIFPPRWMVAEHTFRPPYYHRNYMNELMGLVRGEYDAKKEGFSPGGVSIHNCMTPH… |
| A0A835S3R6 | 304-454 | None |
| A0A2K0US52 | 1-143 | None |
| A0A366S7I0 | 828-977 | None |
| A0A838EXI3 | 39-166 | None |
| A0A6S6VQC0 | 319-478 | None |
| K5WEV0 | 135-279 | None |
| A0A661NP96 | 824-976 | None |
| A0A395IIL0 | 157-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.