DPCstruct | MC58503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 115 ± 5 aa |
| Standard deviation of domain lengths | 5.07 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553L7P0 | 1-117 | MSEFLLAMDSGTSPLVGHQVMLNSNIQADESLLINAAEAGRIELIAFVYAEINLMSFKYQPGDQLWQPNSGQEQAISLDSLRQQATN… |
| A0A2E0YZZ1 | 153-270 | FPTDLAPVVGQQVTLDNTNFLAVNPRINVLIQRANTNFDSFMLGGTVKECELIVKGTVGGAERGWLYRPASNDFLSDVNTTTTDSPL… |
| A0A2V8MCE5 | 319-427 | None |
| A0A7Y1ZG96 | 65-178 | None |
| A0A2D9U1T1 | 129-246 | None |
| A0A7Y3B5J6 | 721-835 | None |
| A0A7Y4RBE0 | 562-682 | None |
| A0A7Y3EEH7 | 408-526 | None |
| A0A7C3KYS2 | 345-464 | None |
| V4J3R0 | 211-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.