DPCstruct | MC58502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 100 ± 19 aa |
| Standard deviation of domain lengths | 18.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M9CLB6 | 1-117 | MKRLLFILPLAIYGCGNSERPDSEVVVDESVLSIYTRESYPRTYQLWGDSGIERIKSVERSALFKAGKQTRCDQVEYVGLSEKLSRA… |
| A0A849UX96 | 84-166 | RMSPGALSPYRKEAYPKLFAEFGSRINEIENFKKKAAEMALDSGKCDFVEYVDMSIENSTLEHLKFWVDCSNKQRIRLDENQL |
| E8LMG2 | 248-330 | None |
| A0A1I6W0D4 | 4-88 | None |
| A0A0Q8EG66 | 86-219 | None |
| A0A5B8CJW7 | 38-157 | None |
| A0A2W6ST08 | 9-103 | None |
| C5SZM9 | 69-167 | None |
| A0A2Z6IET4 | 234-318 | None |
| A0A4Q6Y3A4 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.