DPCstruct | MC5850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 8.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E4W322 | 326-404 | DLEVAQELYAEQLKDVSMVVMLASMLHSIGVGNMLPAWVRVVCVDINPAVVTKLADRGSSQTAGIVTDVGLFLHQLAGR |
| A0A162UDB7 | 2-81 | RVHCKKATTVICLATQLHTIATGNMTPMFRVDGDTIRPVYIYTVDISEFGVNKLRDRGSLEVTSIVTNVQDFLVNIANNL |
| A0A2V7TUQ0 | 2-63 | None |
| A0A7V8W4M3 | 55-136 | None |
| A0A7V9SHE2 | 6-81 | None |
| A0A645JHW5 | 19-106 | None |
| A0A3M1QIJ7 | 322-399 | None |
| A0A7V4Q7C2 | 39-130 | None |
| A0A842Q593 | 221-304 | None |
| A0A843EBX0 | 104-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.