DPCstruct | MC58499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 268 |
|---|---|
| Mean domain length (aa) | 114 ± 18 aa |
| Standard deviation of domain lengths | 17.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0CTT3 | 5-111 | IEQYIAQLPAHQQEIVESLRTLAASAAPGASEVIHYGSPAWRITKGHIAIVRPSKAHVLLAFDRGADFTDDHGLLEGSGSRSRHVKL… |
| A0A1H0DPN4 | 4-84 | LDEAIKWGHLVYLSNGPVLLIRAEESRVLFGFWRGQRLREMDPLLKPGGKYEMATKEFREGDEVNAVLSRRLAKEAVRLNK |
| A0A4R9L227 | 10-130 | None |
| A0A7W5Q1R6 | 40-201 | None |
| A0A812XS54 | 958-1081 | None |
| A0A3S5EWE3 | 14-120 | None |
| R5W4S5 | 166-291 | None |
| A0A8A7WL38 | 5-115 | None |
| A0A1W9SNP3 | 75-197 | None |
| A0A1M6PUS2 | 103-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.