DPCstruct | MC58494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 9.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183TYB4 | 1-89 | MPGAQYYDGSKLVIPITHEAGIALHDHWMQQGVSTLISAIAQQKIKELSEHYKHQLQRCSSRAQSVYEHARCLVATLDINAKSVRSK… |
| A0A183G825 | 113-191 | YDGKKTTITISTEGGEMLFQHWLDQALSGLLATVATNKLKNVGEVERAAHKECAKDSTTLKKHAQCVVALLDAEAKYQR |
| A0A368FX97 | 79-161 | None |
| A0A183U0S7 | 4-104 | None |
| A0A0B2UXV8 | 16-102 | None |
| A8PI54 | 1-101 | None |
| A0A0D8XQS5 | 37-128 | None |
| A0A6V7XZN6 | 14-107 | None |
| A0A0C2GUZ7 | 74-156 | None |
| A0A0N4T2X3 | 35-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.