DPCstruct | MC5849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 130 ± 23 aa |
| Standard deviation of domain lengths | 22.63 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7K4D1 | 1-89 | MNIELTKNQYQTLLILMYCGEWMLNSYKTKEDEIYKKTDKFEKYIFSFAKEYGFDKWIEYDEESGKYFSTDLMDNDLRNYIAKYNKR… |
| A0A162SVJ3 | 1-129 | MKIDFSREQYRALIKLIYAGNILMNSFREKEEINKEYEELEYYVYSFAKQFNCETFIEYDNEFKEHFPTPQFDGYMRKKISDYENYV… |
| A0A3C1W7Z1 | 32-194 | None |
| A0A1J5ITK2 | 14-163 | None |
| A0A1F7WI30 | 27-170 | None |
| A0A4R1QZA0 | 1-141 | None |
| A0A1F4XLF5 | 1-156 | None |
| A0A3B8KBG6 | 250-383 | None |
| A0A7W0EIM6 | 1-131 | None |
| A0A0G0DD80 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.