DPCstruct | MC58489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 172 ± 32 aa |
| Standard deviation of domain lengths | 32.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.24 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0012- CL0020- PF18052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2VS04 | 85-250 | RLMKNVIPSTGKVAKDAKECVQECVSEFISFITSEASDRCICEPLIRQCNAFLEGIESQIMLPILRGYLKLYTTLPTKKLASFMDVA… |
| A0A7S1D7B8 | 30-196 | PPTGLLEESLLRNIREKHGAQLGRIDSGEDGYEDLFLFACPKFISPSLEVDAYRMQIRQFGKEIATQHSSRKLRSYMKLYTSIAVSK… |
| A0A7T8KAK2 | 2-115 | None |
| A0A821IES1 | 7-150 | None |
| A0A0R3QWE1 | 56-321 | None |
| A0A1W0X8J8 | 424-608 | None |
| A0A5N5HS46 | 69-231 | None |
| K3WAX7 | 47-219 | None |
| A0A4Y7M7E7 | 237-436 | None |
| A0A0G4M2V6 | 17-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.