DPCstruct | MC58485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 570 ± 84 aa |
| Standard deviation of domain lengths | 84.12 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2VJ42 | 80-613 | HIIASFFGFAPMYRVLGMCYLVVKVFLLVLIEIGFFPIVCGWWLDICSLPLFASTLPRRLASFSGSPTSSLFLHWLIGMVYVFYSAS… |
| A0A0F4YSW3 | 544-1179 | IIGYIFASLLGLLYLKITGLISGVNRGQRIEGVVADVLHQAGGVMKVILIIGIEMIVFPLYCGLLLDLALMPLFENATLASRIEFTK… |
| K1PGE1 | 313-875 | None |
| U7PSI9 | 1119-1888 | None |
| A0A811PNY6 | 515-1043 | None |
| G0S8R7 | 430-1157 | None |
| I1BUD5 | 158-707 | None |
| D7L5H4 | 176-625 | None |
| A0A015L3G1 | 95-537 | None |
| C1HD92 | 1037-1658 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.