DPCstruct | MC5848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 250 ± 20 aa |
| Standard deviation of domain lengths | 19.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9B945 | 118-356 | ELQFFRRVIEEGTWLQPGGIAILVTPQDVFAKPAVTQHLARHYDNLTIMALPAALRRWREAIVIGVRRSRARSGQALSDTITTLTTQ… |
| A0A161WQL6 | 1-239 | MGQTVRAEEAFFLENSLLNASEGVHIFELPIHQLTGIENLLKKILYRYEAVHIFKFPKKDFLRYKQVVVIGVRKKTNSADLEKAEIL… |
| A0A3A9BHY1 | 234-499 | None |
| A0A2S6IY95 | 1-240 | None |
| A0A534WUV3 | 1-286 | None |
| A0A1D9P5G8 | 121-377 | None |
| A0A0A8WMX3 | 130-365 | None |
| A0A7Y5BNV1 | 106-341 | None |
| A0A4Q7XX82 | 105-332 | None |
| A0A533S4M2 | 130-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.