DPCstruct | MC5847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 130 ± 8 aa |
| Standard deviation of domain lengths | 7.88 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0M796 | 11-127 | ADKLSRVFANVLSSLATPILLAGENLTPDEAAALDGLLPAFMLDACSVWETISGNPVEAPISYDPDALMGVRVADMPDLPATVVLAC… |
| A0A1U9L392 | 4-139 | SPAVTLLSDVLVRAIDRKGLGVILSDATNSTPCASTVAASSSGFLPAFLITAEALWFEMTRHGFGLKLVDDPEAALGVTVLDHDAQS… |
| A0A845UQA4 | 206-337 | None |
| A0A149RB14 | 408-538 | None |
| A0A240UJN6 | 38-171 | None |
| A0A4U1I9K2 | 1-140 | None |
| S9QWL1 | 78-203 | None |
| A0A7W4NSH0 | 1-121 | None |
| A0A7W4XED6 | 147-270 | None |
| A0A6N7ZWJ4 | 117-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.