DPCstruct | MC58469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 286 ± 45 aa |
| Standard deviation of domain lengths | 45.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 12.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1JC82 | 210-496 | IPGVITPEWHQRLYGDDGVTQQLVIEPKGRDELTPPVSVEIQSGAGIAVIPYVELLATTRGRKLLRLSNEHQEIPWQFVVSTDEHDE… |
| A0A377GWW8 | 86-330 | NLPLYEDIIENISLNSCNLNINNLTLFNVNIRVLNYKKFKLIEFKTREFKLALSIQLFDDKTIRKAGDYFSYEIFSKLKDIRLIAVA… |
| A0A1I0FP25 | 1-267 | None |
| A0A838ZUY6 | 172-522 | None |
| A0A1H7PP66 | 37-319 | None |
| A0A7W1FHD4 | 25-281 | None |
| A0A416B0P3 | 102-436 | None |
| A0A1T4XE36 | 1-215 | None |
| A0A1T4K5J8 | 5-233 | None |
| A0A1W9ZGW0 | 17-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.