DPCstruct | MC58468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661PF72 | 38-103 | EGCSCVNQNTQPCYSGPPVTQNVGLCIGGTQTCTNGAWGACAGETTPIPEQCDGLDNDCDGSPDEG |
| A0A7V3NPK7 | 21-90 | PTCNQKKFCPINGQTRACYTGPKGTKGVGLCQAGKQTCVKNQWSVCRGQVLPQKEVCDDDLDQNCDGADK |
| A0A7Z9UNI0 | 141-204 | None |
| A0A4Q3JXU0 | 1-54 | None |
| A0A521UM96 | 342-412 | None |
| A0A521ULN0 | 427-502 | None |
| A0A521UGM9 | 378-447 | None |
| A0A662QVS4 | 143-205 | None |
| A0A3B8LP30 | 675-737 | None |
| A0A2D9HAN1 | 115-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.