DPCstruct | MC58462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 109 ± 22 aa |
| Standard deviation of domain lengths | 21.66 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 46.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A224Z7K0 | 17-96 | YCEEPASVFPFEWPDDITKWPVCRRSHASRKVPDAHMSCEVVGRPCCIGVYGECHITTRDYCDFVGGFFHEEAALCSQVS |
| A0A0S7G3R0 | 124-270 | STLAEWVKWPNPTLNTPQLNGKDRQYGSVCHQDPSICVEPASMYPHEWPDDITKWPICTRYNTGNHTNLPHIDCTITGRPCCIGTKG… |
| A0A183B183 | 302-433 | None |
| A7RJJ9 | 176-274 | None |
| A0A183RBR3 | 119-201 | None |
| A0A817J5E0 | 373-500 | None |
| A0A183KSE1 | 259-352 | None |
| A0A7R8WKD8 | 2-99 | None |
| A0A1S8WNG5 | 93-188 | None |
| A0A1S3JGA4 | 283-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.