DPCstruct | MC5846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 89 ± 14 aa |
| Standard deviation of domain lengths | 13.90 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.47 |
| Pfam Score | 94.74 |
| Assigned Pfam label(s) | PF00590- CL0059- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2BLX6 | 129-211 | MTVAQCAQQMLEIEEEKGGKVYNEDSLAIGCARVGAEDQRFACGTLKELCDIELGPPLHSLVLLGKRAHELERDYIRLFAVNE |
| A0A832ZL02 | 1-80 | MTISDALKILLELEARNKGNIITSKTIVIGLARLGYPDELIKAGELEKIINYNFGPPPHTLIIPAKLHFIEQDILRKLYW |
| A0A1E5UVA9 | 615-698 | None |
| A0A2H6JZR8 | 17-101 | None |
| A0A158R2C0 | 514-606 | None |
| A0A183M2V0 | 10-117 | None |
| A0A0S7E7Q9 | 172-269 | None |
| A0A1V4V583 | 9-92 | None |
| A0A1S8VZ44 | 9-97 | None |
| A0A835P1K9 | 179-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.