DPCstruct | MC58458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 153 ± 18 aa |
| Standard deviation of domain lengths | 17.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8KA45 | 169-302 | DPDMEDIAFLTVAEIATSPNPFLPLIPGNRWVYEGEDEIITVTVLDETKEILGIEAIVVQDVAEEEGEVVEDTFDWYAQDEDGNVWY… |
| A0A7W0R712 | 1-155 | MTVAVGLCTVLGFWSGAQSWVKTFTIEGQQLATVGESTYAVLKPGYQLTLENQDRERLVVTVLNETLNVGGVETRVVEERETKGDRL… |
| A0A564WB77 | 11-140 | None |
| A0A2V6YDM4 | 8-136 | None |
| A0A1F6EZX7 | 103-269 | None |
| A0A7T5R911 | 2-153 | None |
| A0A1F7IFB3 | 30-189 | None |
| A0A1H5JJZ5 | 7-162 | None |
| A0A521H7U5 | 166-319 | None |
| A0A6B3NBC5 | 335-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.