DPCstruct | MC58453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 169 ± 37 aa |
| Standard deviation of domain lengths | 36.79 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0020- CL0187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644TWS2 | 14-168 | LAGREKTAAANAAKADADAAKAAALTELDNAQARYDWAKGNNAENNYPDLFAKGGSDLAKAKQSYDSGNYADASAMAKEAMKSLSNI… |
| A0A661XCM1 | 21-169 | ISPLEEARLEAQEAINNAESKIEELKSIGGDITEPQSLLDEAKKLFEEGKYKEAKEKAIKAYNVASKLYDEIIEARKKLEEMAKKEE… |
| A0A7V5H084 | 10-205 | None |
| A0A521ABG4 | 17-181 | None |
| H7EHN5 | 31-209 | None |
| A0A847PL58 | 166-328 | None |
| A0A7Y3JHI9 | 207-312 | None |
| A0A1G3KK40 | 241-464 | None |
| A0A353PSP6 | 33-211 | None |
| A0A7C1J0I8 | 6-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.