DPCstruct | MC58444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 137 ± 15 aa |
| Standard deviation of domain lengths | 15.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7G748 | 11-146 | ECACCFDDIEGGTDGNYVEYRTGEGKEWRPSFFCKMCIGVLIKSQWSIYEDTLAKATCKAQQKRMLGEGPPTHVHDKTALKCEEGES… |
| A0A7S4VY55 | 165-309 | SCQITYEDITPSECVEYCFGEAPSQWAMTQLSLDALETYRGTKFEAWKGMLVHPTCEAQFRRMLQIGMVSELYDPHVFPTPESLKSK… |
| A0A0G4FTQ5 | 809-950 | None |
| A0A1A8WXI4 | 126-274 | None |
| F0VQ41 | 4-121 | None |
| A0A482S8Z7 | 10-133 | None |
| U6LSI3 | 76-195 | None |
| A0A7S2SE21 | 24-160 | None |
| A0A7S1V345 | 1-114 | None |
| A0A1V9ZRX4 | 273-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.