DPCstruct | MC5844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 60 ± 8 aa |
| Standard deviation of domain lengths | 7.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P0B0D4 | 29-74 | LVYRSGQVNDCPGCGGRAWQVGRNLAECANEECGFALPFAPPADVS |
| A0A1B3MWW7 | 12-70 | MIAVYRPGGVMHCPDCGQSQWLIGRVMAECACCEAALPLDLGYRAWLDITNAPPRSLRL |
| A0A2D5DIY3 | 3-70 | None |
| A0A1H9NBW7 | 3-61 | None |
| A0A396RNN2 | 14-66 | None |
| A0A6G6Y093 | 74-130 | None |
| A0A0Q4CJ14 | 6-57 | None |
| A0A5C6TXK2 | 1-61 | None |
| A0A840HXT4 | 14-73 | None |
| A0A2U0SIL1 | 32-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.