DPCstruct | MC58439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 292 ± 27 aa |
| Standard deviation of domain lengths | 27.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 32.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7G0S4 | 1-305 | MHVPGFDGGDCCECTCVSVYDDDYSCSSTDSGFACVDPTAPCVDDDDITIEQALNCFPREFGDGWCDQENNNEICGYDGGDCCECTC… |
| A0A2C6LGS2 | 148-417 | ALREHFPECPAECLEDWVGDGWCDSECNVAECGYDGPDCEGWCGGECRPGWPGDGQCDVECYKEECGWDGGDCKDWQDRNLPSAHEL… |
| D7FLW0 | 27-280 | None |
| A0A6H5KJK5 | 1-332 | None |
| A0A6H5JVP4 | 31-346 | None |
| A0A7S7LEA3 | 34-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.