DPCstruct | MC58435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 118 ± 26 aa |
| Standard deviation of domain lengths | 26.09 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.29 |
| Pfam Score | 90.04 |
| Assigned Pfam label(s) | CL0123- PF01286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7FX65 | 11-114 | ISVCRTCKMSREEFQYVSTKDVKDTYLLPQGTIAVLKFVERDNPHHSSWTKMKLYLRREVVAYSYKRWGSEDGLAAERRRRESLKYD… |
| A0A4Z0A4G5 | 97-173 | TWPPSKLSPDMTISKGLAKDWYKLTHKDLKPLSFVVDGNREGYPMHLYKAVEVEHAAWQKYGGPDGFEEMLKKKEAE |
| A0A6P6QU15 | 668-783 | None |
| A0A2B4SLK1 | 99-208 | None |
| A0A1D2NHB1 | 169-300 | None |
| A0A5S6Q3L2 | 79-205 | None |
| A0A1A8YGQ3 | 230-382 | None |
| C1EF71 | 240-326 | None |
| A0A7R9Q4T4 | 107-258 | None |
| A0A0G4HC29 | 120-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.