DPCstruct | MC58423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 100 ± 6 aa |
| Standard deviation of domain lengths | 6.41 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 60.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821AC86 | 1-94 | MHYMQDNATVIAGGRGNHAYILAAAPIYDEWIRNNYELRVWQTYLQIGIQGRHWAKEVSTRIKKRGNVINNRFIKKKINRLTNNIAQ… |
| A0A815R5Y6 | 18-118 | YLEPSRILRFMQDNAPNLMGSRGNQAYVLATTELYDKWVRINYDLQVWQLYLKMGTQDKYWSKEVIKRTKRRDDNINTRFTQKKINQ… |
| A0A816RDK6 | 1-94 | None |
| A0A820KMH5 | 33-133 | None |
| A0A817SL34 | 3-115 | None |
| A0A819R8D7 | 6-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.