DPCstruct | MC58418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 184 ± 24 aa |
| Standard deviation of domain lengths | 23.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820W8W9 | 232-416 | LLINGFTLFGLCFVSFLGDCLCFGRPFSIYSPSNTYVRALTDNLTHGLVSVFATSFLFGWTRRSLLIIALIAGSFVDIDHFIEVRSL… |
| A0A7R8YPJ6 | 7-193 | VYVRLILATLVSITCIVGDNLLETTRHPLLKALCDNATHAIVGGLTGIAFIMHFYDKLSNVAGWTLIFACFAVSSFIDLDHFAAAKS… |
| A0A2H5Z265 | 2-172 | None |
| A0A654GHY3 | 274-490 | None |
| A0A817KZI2 | 231-424 | None |
| A0A817Q603 | 6-191 | None |
| Q6DC75 | 14-208 | None |
| A0A194QYU3 | 1-136 | None |
| A0A6F9CTR5 | 177-370 | None |
| A0A1F8T092 | 25-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.