DPCstruct | MC58412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 640 |
|---|---|
| Mean domain length (aa) | 138 ± 23 aa |
| Standard deviation of domain lengths | 23.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 11.41 |
| Pfam Score | 39.29 |
| Assigned Pfam label(s) | PF20242- PF20033- PF02792 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A091AYF4 | 139-271 | KHVPLPQVPLDQVVIALSRSGCYGTCPIYQVEIHGDGRVVYQGDDFVDVRGTHAYRVPVEEVRRLVDSLREKDIWSLRESYRGGWTD… |
| A0A840L5H2 | 21-154 | ACAQAPGALAALPQIQSITLERDCFGCSRGSRLQLQSDGLLTLTLSGKARHGTVDQVSQGRLAAGDFERLCRLLQEQGFFALPERIA… |
| A0A2W5YI53 | 2-91 | None |
| R6H2M7 | 145-269 | None |
| A0A268ETL6 | 6-125 | None |
| A0A1G9N2V2 | 24-178 | None |
| A0A1F7AVW9 | 6-113 | None |
| A0A3E2V1C9 | 1-113 | None |
| A0A7Z3BIT0 | 20-199 | None |
| A0A414R9V2 | 129-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.