DPCstruct | MC58407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A810NRY7 | 1-73 | MALKFLGKDPNSPSGGSPTIYLDTERDTYVVQGWRVEDPERLAQMAIPGHETVVEIPRYMTKFFEEAPGDASS |
| A0A7W3LU61 | 1-73 | MALDFVGVDPGNPDDDCPAVWVDSETGDFYFQGETVTEPDTLAWINSDSRLKDTESVVRLPAAMAQIIMEAAS |
| A0A1B1ZKZ9 | 3-66 | None |
| A0A5M3XGD5 | 38-100 | None |
| A0A2G7CCB9 | 201-280 | None |
| A0A372GM12 | 64-136 | None |
| A0A372ZQC0 | 15-95 | None |
| A0A6G4AEC0 | 1-72 | None |
| A0A5S4FBY0 | 11-81 | None |
| A0A7J9YFY0 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.