DPCstruct | MC58404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 118 ± 27 aa |
| Standard deviation of domain lengths | 27.02 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 93.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06792 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3D3A2 | 152-247 | MRTTVDENKKFTGFIADKLNKSSSKVCVCLPQKGVSALDASEKPFYDPEATGALLNELQRLIQINNDQQVKMYPYHINDPEFAKAWL… |
| A0A090YMX4 | 2-94 | RTTAQENRAVGEKLAEKLNLASGESVLIMPLKGVSMIDAEGQPFHGPEEDLALFDALRANLDRSKVELYELDAHINDDSFALNAAKK… |
| A0A4Q3Q408 | 61-186 | None |
| A0A6G1DWB2 | 94-234 | None |
| A0A2A2HGH4 | 46-172 | None |
| A0A7G6T3N9 | 597-719 | None |
| A0A4R6KMJ6 | 10-101 | None |
| A0A7W0STV4 | 42-164 | None |
| A0A225ACP1 | 271-420 | None |
| A0A445EX67 | 321-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.