DPCstruct | MC5840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 252 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Standard deviation of domain lengths | 22.12 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.29 |
| Pfam Score | 96.41 |
| Assigned Pfam label(s) | CL0644- PF00057- CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803XKG7 | 1-82 | MPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLRC |
| A0A6M2D886 | 11-159 | LIAVVALSQPTLGHSVSSRADEHHRCEPLTIPMCRSLQYNMTTTPNLIGQEQDEAGLEAHQFYPLVQIKCSPDLQTFICSVYAPECR… |
| A0A4W5PEU4 | 240-398 | None |
| A0A2C9JFZ9 | 18-199 | None |
| A0A6P5VWH5 | 286-429 | None |
| A0A821Q6F4 | 2-161 | None |
| A0A3Q0J678 | 63-202 | None |
| A0A7M5WU12 | 16-142 | None |
| A0A6I8P7L4 | 465-581 | None |
| A0A1I8HZS8 | 367-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.