DPCstruct | MC584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 163 ± 17 aa |
| Standard deviation of domain lengths | 17.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 36.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819QLR1 | 90-237 | MLLYRHPTQCSATIQMFLDYNKHYWPFVPMTIEEANQDDTNYQRVHATTTMSNVHLDRDIRKYLKAVPKPPAGYKFSKYQIEKQAKF… |
| A0A819JXK6 | 1-157 | MKLYQHSTQCPVAMQIFLHANPQYWRFVPMTLEEAERPEQKNIEPVIFSEVFWNMRSKEDTLICVQAVPKPSHRFTFSNRQIMLQTQ… |
| A0A820GXG8 | 60-204 | None |
| A0A819X5F5 | 39-204 | None |
| A0A815S712 | 173-338 | None |
| A0A815T5D1 | 500-645 | None |
| A0A815U5A4 | 48-218 | None |
| A0A821H220 | 79-258 | None |
| A0A820KZI5 | 7-147 | None |
| A0A820X899 | 329-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.