DPCstruct | MC58393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 127 ± 16 aa |
| Standard deviation of domain lengths | 15.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16138 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5T029 | 1-144 | MYLKTIAALLLLIGPSCSGGQSSASEPTTLPVPALSPDTITTIQKIPLPAGYKRISHPLHSFAGWLRDLPLKEDKTVYLYNGQLKRN… |
| A0A662B1J6 | 2-103 | NKINDIPVPDGYERIKSVDLSFGWYLRNLSLNTVDNTVYSYDGSVIMGEYGYQYAVINMDIGKRDLQQCADAVMRLRAEYLYYQKKY… |
| A0A3L9M9J7 | 207-353 | None |
| A0A3N1X6B0 | 189-312 | None |
| A0A2E0XNB8 | 9-143 | None |
| A0A7X8PZ18 | 329-467 | None |
| A0A1I0RWY8 | 1-118 | None |
| A0A3E2NL37 | 13-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.