DPCstruct | MC5838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 5.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 52.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5XV61 | 135-207 | MTFLFPPKYTHSRYWLWTVGVFILAKMEALADMKIYRANNYIISGHSLEHLCSAIAPVLVTVMLMHRSCRFPR |
| A0A484N8Y0 | 53-135 | QFVPCIAIPLMAILMPPMYTHSVYWLWAAAFYLIAKIEEAADKPIYRWTHHVVSGHTLKHLCAAMVPVFLTLMLAKREIETER |
| A0A396GNZ6 | 1-75 | None |
| A0A1H8MZV2 | 46-128 | None |
| A0A3L6QWP5 | 200-287 | None |
| A2ZQA3 | 117-202 | None |
| A0A0D3EKP7 | 162-241 | None |
| A0A1R3K3K4 | 335-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.