DPCstruct | MC58378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 83 ± 2 aa |
| Standard deviation of domain lengths | 2.28 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 96.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 36.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6VXZ3 | 1-82 | MKLQIATDIANTETVFSIADAVHDVIDILEVGTPVITKEGLVPVYHVKLRYPNLCVFADTNIIDGEAMECEDACKAHADIVM |
| A0A7J2YIT3 | 4-86 | ILQVALDFTSLEQALRVAEAAVSGGADWLEVGTPLIKSLGISAVKLVAERFPNVTVVADMKTIDTGYLEALMAASHGARVVTV |
| A0A661WHE6 | 6-85 | None |
| A0A376JQE4 | 1-84 | None |
| A0A2D5YX50 | 1-88 | None |
| A0A1Y6ML77 | 278-360 | None |
| A0A7Z9WF55 | 141-220 | None |
| A0A6M1HUX7 | 1-84 | None |
| A0A256YIA7 | 4-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.