DPCstruct | MC58375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 581 ± 89 aa |
| Standard deviation of domain lengths | 89.30 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 13.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0SXM9 | 18-569 | LQVSQILEREDDPHLIMMAANCYYVIRDYEKAEFLSLKAIAYNGNIFDENLFAQYVRINIGPKPGIPDIAELEAIIIDCTVLLESES… |
| U7NG71 | 2-456 | TVCENAAFEIDDGRGHRLWFVIEPEEGLRKDETYIPPDNDIARRTIGLSVGDQIEWEGSSFPWKVLAIKHKYLHALHRSMGNYERLF… |
| A0A7X0JKQ7 | 140-738 | None |
| A0A5F0YLY6 | 438-1108 | None |
| A0A4P7HJF9 | 2-453 | None |
| A0A5E6X4S1 | 1-585 | None |
| A0A2Z6AN13 | 63-650 | None |
| S6ESS1 | 430-1052 | None |
| A0A6H2CDI4 | 371-982 | None |
| A0A523Q6Q9 | 486-1136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.