DPCstruct | MC58371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 235 ± 22 aa |
| Standard deviation of domain lengths | 22.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 29.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420QAR9 | 1-273 | MLDKTLSQFLEDQAFKEFYAPEGERNLTFNKGCRFIDIEFTPKGIKTEGHLWKLGGIIDPARFLLPLPEAKNKTYSVTQDEQRCLAH… |
| A0A178ZPG0 | 88-325 | NGEILMNGEGGGSSSRGNNMAPLNRTVFDFLKTQSLDSFSPPIRQQLTFIKSCRLIQVQLVKDGIQTRGHLWEIGPQISVNVRRRVP… |
| A0A365N1N1 | 138-363 | None |
| A0A4Q4TZ06 | 84-286 | None |
| A0A6M7ZQE0 | 246-493 | None |
| A0A2T3Z6P3 | 237-447 | None |
| A0A6A5K690 | 884-1118 | None |
| A0A1J7JXF0 | 24-282 | None |
| A0A6A5S5D6 | 336-588 | None |
| A0A4Q4VAJ5 | 863-1100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.