DPCstruct | MC5837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1120 |
|---|---|
| Mean domain length (aa) | 144 ± 25 aa |
| Standard deviation of domain lengths | 25.42 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.01 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0113- PF04479- CL0020- CL0177- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3HEZ4 | 7-136 | GRASKRIQKELEKFQTEASDDGLTLEVVSDTVWQISFIGAPGTVYEGEPYTLRLRFTDDYPMDSPEVVFLTPAPAHHHVYSNGHICL… |
| A0A7S4RA55 | 3-129 | RVMITGPDDTPYANGCFLFDINLPGTYPKVSPKVRFLTTGGGKLRFNPNLYNCGKVCLSLLGTWAGPGWVAGQSTLLQVLISIQSLI… |
| A0A0B0PTC8 | 20-174 | None |
| A0A7N2KTW5 | 286-450 | None |
| A0A4R2JSH4 | 176-317 | None |
| A0A6P8HU19 | 5-150 | None |
| A0A654HLR9 | 738-874 | None |
| A0A654HH26 | 161-303 | None |
| A0A1V2LPS2 | 103-281 | None |
| C1H516 | 33-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.