DPCstruct | MC58365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 133 ± 17 aa |
| Standard deviation of domain lengths | 17.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 13.39 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF05076- PF12470- PF11979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3IRC4 | 82-225 | RMLRVHGSTLDLQDDESRLVIPLWAKSDLKNLVESNRNMIAFALDFNADADSHLVCEQDATGSYRTQVFTTGVTARKVTGASFIIVD… |
| A0A7C9J658 | 150-271 | LRADSTAELELSGTRPELRALGRFLRAGRGRRGLLENREPSPYSRSLSELQFQETPGSVIRILVDGSSLKIFGGRAALDLLADDIED… |
| A0A7Y4TJE2 | 22-123 | None |
| A0A1F3XXH8 | 1-135 | None |
| A0A5C7YQM3 | 49-167 | None |
| A0A654HT31 | 647-800 | None |
| G8LVZ1 | 5-136 | None |
| A0A826WYJ4 | 2-129 | None |
| C1H884 | 293-436 | None |
| A0A172ZJ09 | 82-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.