DPCstruct | MC58360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 186 ± 17 aa |
| Standard deviation of domain lengths | 17.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W0V6B5 | 1-184 | MNTLQAPVPALRCAPNGVNGASGRYIEAALAPEQLSALALGLPAHPAACGARHKLAQAEPHLAPGYGIDAEQLAQAGWGVLFHSAAE… |
| B8G552 | 430-654 | DELYPNGIDGRRGEPLLRIDAKAASELAQRSDDPKELQTLHKTRNEAEERHFGVVADVDQEDLAQARWAVMVNAVDDARIIQALWPL… |
| A0A2T4V8U0 | 1-156 | None |
| T2JSH5 | 478-664 | None |
| A0A2D2CYY5 | 675-853 | None |
| E1IFL6 | 247-444 | None |
| A0A7C4LEU3 | 1-195 | None |
| A0A543LCW3 | 1-173 | None |
| A0A1U7NA54 | 1-185 | None |
| A0A7Y5KV73 | 571-744 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.