DPCstruct | MC58354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 201 ± 20 aa |
| Standard deviation of domain lengths | 19.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151S7L5 | 3-193 | LNAISKLLRHRWTWRVTGFVSSIVGFYCYALSPSLRYLIGAWSLVKKVVYGLVSALVCTSTLLVHRDSCAWARGSGPFLKTLVGFAA… |
| A0A3Q7XU72 | 2-208 | LNKILSWLKQPKIWKFVSFTSSIIGLLFYSLSSSFNNLFGKWNLFKIFVYTVFSLIICLAILFANTCHTSSLKLKTHLIFSVFTATT… |
| G7K5T6 | 5-208 | None |
| A0A151S085 | 3-189 | None |
| A0A6P4C530 | 7-190 | None |
| A0A396GWF5 | 3-206 | None |
| A0A6A4PWX0 | 1-146 | None |
| A0A444YBA6 | 234-451 | None |
| G7K5P6 | 5-186 | None |
| A0A6P4DZ18 | 26-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.