DPCstruct | MC58353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 168 ± 30 aa |
| Standard deviation of domain lengths | 30.00 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151RS72 | 3-195 | QFEFQIDKEALRKDFASEENQPQRSWFLKKYQGSKRLEIQEIYYNFLNYVKLNIPFLDWFHAYTIKKNIDYPFRDDLIGQHSTNVIW… |
| A0A0R0JLV4 | 1-146 | MLSNNFSIDKDTLRKDFYSPENEPQRRWFFQHFKGLNRKQIQDNFYEFVKRVKINVLFFDWFHSYTIKVDMDYPWKQDIISDPTTKV… |
| A0A151TZV1 | 60-186 | None |
| A0A836API1 | 180-375 | None |
| M1DNV5 | 7-189 | None |
| A0A837A447 | 75-268 | None |
| A0A151S9A7 | 24-229 | None |
| A0A151SX61 | 4-196 | None |
| A0A151RPB4 | 4-138 | None |
| A0A151S3M2 | 197-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.