DPCstruct | MC58352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 2.94 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 64.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151RJ61 | 1-60 | MSHELIIHCQNEIKDLLSKGLIRKSKSHWSCAAFYVNKASEIECGAPRLVINYKPLNQAL |
| A0A6P6BAA8 | 1-60 | MNSDHFKQAIQECSLLQAQGLIEPTSSPWACEAFYVNKRSEQVREKLRLIINYKSLNIFL |
| M1A323 | 1-52 | None |
| A0A151RZ33 | 509-568 | None |
| A0A151RPB4 | 650-701 | None |
| A0A438JVF9 | 484-541 | None |
| A0A438JNJ6 | 805-862 | None |
| A0A1S3YWZ8 | 471-522 | None |
| M1DCV3 | 43-96 | None |
| Q60CX3 | 43-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.