DPCstruct | MC58350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 120 ± 19 aa |
| Standard deviation of domain lengths | 19.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U6BTS0 | 2-111 | LTTEELQAIRERAEAATDGKWAYNLLPPSMSFDRKFCLGSFNGVCEIVGDINKEADAEFIAAARQDVPKLLAEVERLNKVLHRISVT… |
| A0A7K2NMH5 | 102-229 | RLSSEREAEIFARHEAATPGPWSANAQIGVVTNEAGDPLAVFGGGEQDRADAAFVAAAREDVPELLAELAAVRAERDQAKERVAELE… |
| A0A410PZS1 | 1-117 | None |
| A0A260MAG6 | 1-113 | None |
| A0A6N8G2G9 | 9-139 | None |
| A0A4R9EXF7 | 1-157 | None |
| A0A418TBT0 | 4-136 | None |
| A0A6G7JCF2 | 1-108 | None |
| A0A7Y6HR65 | 65-188 | None |
| A0A1I4C4I2 | 59-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.