DPCstruct | MC58346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 303 ± 47 aa |
| Standard deviation of domain lengths | 46.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.32 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0020- PF00368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7MNH1 | 5-308 | RRPIKHQSHHRSVKSHTAGELLKPHNQPKASDALPLPLYLTNGLFFTMFFSVMYFLLHRWREKIRNSVPLHVVTLSELAALVSLVAS… |
| A0A409WWR4 | 1-263 | MPMRSSFRLISPPHSSGSSDTSSSEDSSENVKNVVDEVRSLAQCIDIFENGPRPLSESLALLNDEEVIMLAQCGKIAAYSLEKVLGM… |
| A0A446XCL6 | 1-325 | None |
| A0A0V1A4Q6 | 159-485 | None |
| A0A453PE64 | 2-237 | None |
| A0A5N6G5Q8 | 206-535 | None |
| A0A6A2XYC0 | 1-307 | None |
| A0A1Y2HJ60 | 323-646 | None |
| A0A0D8XV37 | 1-295 | None |
| K5WF97 | 1-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.