DPCstruct | MC5834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 7.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0RER1 | 54-153 | REAAKREAFDLLDALTRSGALPLEDTALHVVLAAQHCFGQSLVDTVVVKNVNPIEKVERSALLLATTLHGNCAARTLVRPSEAARVA… |
| A0A7S3HBC1 | 15-107 | LLDALTKCGALPVEHASLHVVVAATHCFDKTVTETVIQNNANPIEKVERSTLIMASAVHRVPPSALIKDSQQPRVKAASPALFLADG… |
| A0A7S4PGM3 | 100-184 | None |
| A0A7S0IRH1 | 126-231 | None |
| A0A7S1MF12 | 278-377 | None |
| A0A2R5GH38 | 1-95 | None |
| A0A7S4SNL5 | 34-125 | None |
| A0A7S1Z8S0 | 117-205 | None |
| A0A7S1Y6V1 | 81-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.