DPCstruct | MC58336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 472 ± 78 aa |
| Standard deviation of domain lengths | 78.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A427A527 | 62-509 | QKVRLHNVLASIPSGSKLPLLILSSDVYDEENTDSSHTITRRLGLHDADMTRIYSFSVVFLCDNDPQLKSNGFLKDDKLREGLLWLA… |
| A0A480PSI5 | 35-528 | RLRRLRNRTAHQMKVQHFHQQLLSDAAWAPLDLPSLVAEDLPGRRERVFWKLVLVLPDGEERSPGSPGRILANWLKVKFMGDDASAD… |
| A0A553PLZ7 | 15-436 | None |
| A0A804QGT1 | 63-452 | None |
| A0A182MT14 | 414-965 | None |
| A0A2J7Q0C5 | 662-1133 | None |
| F1Q712 | 1382-2021 | None |
| A0A1B6BYU5 | 419-855 | None |
| A0A4Z2CI40 | 145-606 | None |
| A9PGN7 | 123-621 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.