DPCstruct | MC58334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 71 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452XCB2 | 18-88 | TCTASAPVTERIQQKLSSSGNPPPQSVQKYVRHQCSKWNLVWVGKDKAAPLEPHEMEYLLGFPKDHTRGFG |
| A0A427A048 | 1-77 | MLTNTASARLTYEIGIELQEFGDPPPLRTQQYVLGECRRCNLIWMGRHSVAPLELAKIEMLLGFPKDHTRGGGITRT |
| A0A6A3BFB8 | 18-94 | None |
| A0A2U1N3X8 | 49-137 | None |
| A0A6A3CYP1 | 143-208 | None |
| A0A6A3CJ49 | 108-171 | None |
| A0A2P6S9B7 | 12-90 | None |
| A0A2P6S976 | 1-54 | None |
| A0A6A2YAJ1 | 44-102 | None |
| A0A6A2Y7C6 | 123-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.